Protein Info for SO0863 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details PF09997: DUF2238" amino acids 36 to 176 (141 residues), 200.6 bits, see alignment E=4.8e-64

Best Hits

Swiss-Prot: 48% identical to YJDF_ECOLI: Inner membrane protein YjdF (yjdF) from Escherichia coli (strain K12)

KEGG orthology group: K08984, putative membrane protein (inferred from 100% identity to son:SO_0863)

Predicted SEED Role

"FIG01058491: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIH6 at UniProt or InterPro

Protein Sequence (201 amino acids)

>SO0863 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNNKIAWCGIYLSVLAWSAIKPADPFTWWLEALPALVAVPLLFFTRKRFELTPLVYFLVL
VHCCVLFVGAHYTYAEVPLFDTIAQWMGSERNNYDKVGHFAQGFIPAMLAREIMLRNQAV
KPGAWCAFLATCFVLAFSAFYELIEWWVAVATGEGAEAFLGTQGYVWDTQSDMFLALIGA
IVALLSLSRVQDKQIAKLTAQ