Protein Info for SO0860 in Shewanella oneidensis MR-1

Annotation: response regulator (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF00072: Response_reg" amino acids 7 to 117 (111 residues), 90.2 bits, see alignment E=1.5e-29 PF13487: HD_5" amino acids 157 to 318 (162 residues), 124.5 bits, see alignment E=5.9e-40 PF01966: HD" amino acids 166 to 286 (121 residues), 79.2 bits, see alignment E=4.6e-26

Best Hits

Swiss-Prot: 44% identical to CDPD2_PSEAE: Cyclic di-GMP phosphodiesterase PA4781 (PA4781) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07814, putative two-component system response regulator (inferred from 100% identity to son:SO_0860)

Predicted SEED Role

"Response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIH9 at UniProt or InterPro

Protein Sequence (339 amino acids)

>SO0860 response regulator (NCBI ptt file) (Shewanella oneidensis MR-1)
MMDKATILVVDDTPENIDILVGILGEDYKVKVAIDGPRALALVTKTLPDLILLDVMMPGM
NGYEVCKLLKQEPLTCHIPVIFVTALSEVADEAQGFALGAVDYITKPVSAPVVKARVKTH
LALYDQKRLLEQQVKERTQELEETRFEIIRRLGRAAEYKDNETGLHVVRMSHYARLLAIK
LGLPSTFCELLYNASPMHDIGKIGTPDAVLKKPGKLDAEEWKIMQQHAVIGAEIIGEHGD
PLLQMARRIALTHHEKWDGTGYPNGLSEENIPIEGRIVAIADVFDALTSQRPYKQPWTIE
ATMELLENQAGQHFDPKLVEEFKQILPEVIAIRNTYFEH