Protein Info for SO0851 in Shewanella oneidensis MR-1

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details PF07963: N_methyl" amino acids 13 to 36 (24 residues), 30.1 bits, see alignment (E = 1.3e-11) TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 14 to 36 (23 residues), 20.1 bits, see alignment (E = 2.1e-08)

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0851)

Predicted SEED Role

"Prepilin-type cleavage/methylation-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EII8 at UniProt or InterPro

Protein Sequence (185 amino acids)

>SO0851 hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSGLAMSPFNKQQQAGFSLSELMIAMVLGLIIMLAVVNFFAPLKATVEESKRLEDAADAL
RYATLTLSKSVKRSSHIASLSANELVLVVVASPTQPSLSCLGTNKTSDYNETYRFSAPNL
SCDDGDSAQILLTGLESTHFTLNGELLTVQLKPEKLPAQFGQGIKLDIALRKSVWQQALN
RQQIQ