Protein Info for SO0827 in Shewanella oneidensis MR-1

Name: lldP
Updated annotation (from data): propionate/L-lactate/D-lactate transporter
Rationale: Specifically important for propionate utilization. Another study named it lctP2 and found that it was involved in utilization of both L- and D-lactate (PMC5603553)
Original annotation: L-lactate permease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 93 (54 residues), see Phobius details amino acids 115 to 182 (68 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 251 to 268 (18 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details amino acids 397 to 415 (19 residues), see Phobius details amino acids 421 to 446 (26 residues), see Phobius details amino acids 518 to 542 (25 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 5 to 534 (530 residues), 712.5 bits, see alignment E=1.9e-218 PF02652: Lactate_perm" amino acids 15 to 532 (518 residues), 694.4 bits, see alignment E=5.4e-213

Best Hits

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 100% identity to son:SO_0827)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIL2 at UniProt or InterPro

Protein Sequence (545 amino acids)

>SO0827 propionate/L-lactate/D-lactate transporter (Shewanella oneidensis MR-1)
MTWTQTYTPLGSLWLTAIVALLPIVFFFLALTVLKLKGHIAGALTLLIALAVAIITYKMP
VSIALASAIYGFSYGLWPIAWIIITAVFLYKITVKTGQFEIIRSSVISVTEDQRLQMLLV
GFSFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIANTAPVAFGAMGIPIIVAG
QVSSLDPFHIGQLAGRQLPILSIIVPFWLIAMMDGIRGIRQTWPATLVAGVSFAVTQFLT
SNFIGPELPDITSALVSLICLTLFLKVWQPKEIFTFSGMKQRAVTPKSTFSNGQIFKAWS
PFIILTAIVTLWSIKDVQLALSFATISIEVPYLHNLVIKTAPIVAKETPYAAIYKLNLLG
AVGTAILIAAMISIVVLKMSISNALTSFKDTLIELRFPILSIGLVLAFAFVANYSGLSST
LALVLAGTGVAFPFFSPFLGWLGVFLTGSDTSSNALFGALQANTANQIGVTPELLVAANT
TGGVTGKMISPQSIAVACAATGLAGKESDLFRFTLKHSLFFCTFIGVLTVLQAYIVPWTL
VFFTK