Protein Info for SO0805 in Shewanella oneidensis MR-1
Annotation: CBS domain protein (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 100% identity to son:SO_0805)Predicted SEED Role
"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
- superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
- superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
- superpathway of purine nucleotide salvage (13/14 steps found)
- superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
- superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
- guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
- inosine 5'-phosphate degradation (3/4 steps found)
- purine nucleotides degradation II (aerobic) (8/11 steps found)
- adenosine nucleotides degradation I (5/8 steps found)
- purine nucleotides degradation I (plants) (7/12 steps found)
- ureide biosynthesis (3/7 steps found)
- superpathway of purines degradation in plants (7/18 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Drug metabolism - other enzymes
- Purine metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.205
Use Curated BLAST to search for 1.1.1.205
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8EIN2 at UniProt or InterPro
Protein Sequence (172 amino acids)
>SO0805 CBS domain protein (NCBI ptt file) (Shewanella oneidensis MR-1) MKLLTSNKRQIAQILARPESNQSIVKKGIYRMKVSDIMSTEVICISDGASLKDAHHLMQT RGVRHLPVISETDGALVGVLTHKKMIASVLSMLNKYGQGALDRKERYTPIATVMDKDCQS LTPNEPLSTVVEYFIDNKLGCLPVVDNNKKVLGIVTSSDFIKLCRTLLQQQA