Protein Info for SO0802 in Shewanella oneidensis MR-1

Annotation: MATE efflux family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 190 to 215 (26 residues), see Phobius details amino acids 238 to 276 (39 residues), see Phobius details amino acids 282 to 298 (17 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details amino acids 351 to 375 (25 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 412 to 433 (22 residues), see Phobius details PF01554: MatE" amino acids 20 to 180 (161 residues), 102.4 bits, see alignment E=1.1e-33 amino acids 247 to 404 (158 residues), 75.6 bits, see alignment E=1.9e-25 TIGR00797: MATE efflux family protein" amino acids 20 to 418 (399 residues), 176.8 bits, see alignment E=3.3e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0802)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIN5 at UniProt or InterPro

Protein Sequence (453 amino acids)

>SO0802 MATE efflux family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MATSAKTLQQRMGIIALTWPIFIETLLQSLLGISDIFMLSHYSDNAVAAVGLTTQLMFFM
MVMSMMVSTGASILISQNNGAGRTQEATDIGVASVALSLGLAVVMGAAMFFCAHGIIGLF
ELEPKVAGYGYDYLLICGSLSIGLVMNIAFAAILRSYGFTRSAMLVTLSTGLMNVLGNYI
ALYSPFGLPVYGVTGVAISTVTSQLMGALIMLAVIRSKHIPLPMQRLNSLPRSTYWSVMR
IGLLNAGEMLSYNVAQMTIIYFISQMGTLSLTAYTYGLNISRFIYCFSVALGQAAQIQTG
YYVGKQWFDEITVRVQKYCLVGFIVSLAIVLIFFWQRFTIVGWLSENPEVIQLTALLLLG
SIALETGRVFNLVIISALKGAGDVAFTVRVGLFSMWGIGVLLAWFFGLYLGYGVLAAWLA
VAADEWVRGLIMVQRWRSGRWQRFTRIPPATSA