Protein Info for SO0743 in Shewanella oneidensis MR-1

Annotation: iron(III) ABC transporter, permease protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 54 to 77 (24 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 196 to 219 (24 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 289 to 313 (25 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 373 to 395 (23 residues), see Phobius details amino acids 409 to 432 (24 residues), see Phobius details amino acids 463 to 482 (20 residues), see Phobius details amino acids 517 to 535 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 70 to 263 (194 residues), 47.5 bits, see alignment E=8.9e-17

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 100% identity to son:SO_0743)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIU1 at UniProt or InterPro

Protein Sequence (544 amino acids)

>SO0743 iron(III) ABC transporter, permease protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MILGLARSWSLTGYAIAVLLVLPLLALLLQAAQPDEAVFGHLLSTVLPTYIANSLWLILW
VSIGSLLLALPCAWLMARCEFVGRRYLQWALLLPLAMPAYIVAYVYTDLLDYAGPVQRSL
RALFGWSSPQDYFFPDIRTLGGAACVLSLVLFPYIYLLARTAFMEQSLNLAHASRIMGCS
PWQSFWRLSLPMARPALAVGVALVAMETAADFATVNYFAVPTLTTAVYDTWLGYGNLTAA
AKLSAIILLVVFSLIGVERFARRKQQLFQKQSRIQAIDLYRLSPMQTLLGLGYCGMLLLL
AFVLPSGILLSYAINYFEQSWDPLFWQLSVNSLTLALITSLVCCVIALVLMFIRRVSPRS
SDALPSRLASTGYALPGTVLAIGVLVPLTLLDFAINDIADWLGMAGPGLLLTGSTVALVF
AFCVRFVAIAIGSVESSYKRISPSLDMVSLTLGQSPRRLLQRVHLPLLTKGLFAGALLVF
IESMKELPAALLLRPIGFENLATYVFQFVSDEKLEHGALPAIVIVLVGLVPLIYLNRSLE
QDNR