Protein Info for SO0694 in Shewanella oneidensis MR-1

Name: galK
Annotation: galactokinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 TIGR00131: galactokinase" amino acids 7 to 378 (372 residues), 308.9 bits, see alignment E=2.4e-96 PF10509: GalKase_gal_bdg" amino acids 11 to 59 (49 residues), 75.5 bits, see alignment 1.9e-25 PF00288: GHMP_kinases_N" amino acids 95 to 182 (88 residues), 53.9 bits, see alignment E=1.8e-18

Best Hits

Swiss-Prot: 45% identical to GAL1_TOLAT: Galactokinase (galK) from Tolumonas auensis (strain DSM 9187 / TA4)

KEGG orthology group: K00849, galactokinase [EC: 2.7.1.6] (inferred from 100% identity to son:SO_0694)

Predicted SEED Role

"Galactokinase (EC 2.7.1.6)" in subsystem Lactose and Galactose Uptake and Utilization (EC 2.7.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EIY3 at UniProt or InterPro

Protein Sequence (381 amino acids)

>SO0694 galactokinase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSNPAQRATKLFVQTFGTKADDLYQAPGRVNLIGEYTDYNDGFVLPAAINFHTVIAVKRR
EDSKFRAVADAFPGQIKEWTFGKETEIHPEDGWVNYLKGFTAAMANTGLIAKGLDLAVVG
DVPLAAGLSSSGALVVAFGTAISDSSQLHLSPMAVAQLAQRGEYRYVASACSIMDHMVCA
MGEPDHALLIDCLDLDSEAIAIPENLSLIIIDAHIEKQRLATISQQRREECAQAAEFFGL
DALRHLDLRQLESAKNKLDETLYRRAKHVVTENKRTQSAARALEQNNISKFSLLMAQSHQ
SLRDDFEVTLPEFDTLVDIVSQVIGERGGIRMTDGCVVALVDHELTDAVVSAVEQAFFEQ
TGIDATVYLCSASSGAGRIDS