Protein Info for SO0628 in Shewanella oneidensis MR-1

Annotation: GGDEF domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 728 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 297 to 455 (159 residues), 121.4 bits, see alignment E=1.5e-39 PF00990: GGDEF" amino acids 299 to 453 (155 residues), 139.2 bits, see alignment E=1.1e-44 PF00563: EAL" amino acids 479 to 712 (234 residues), 204.4 bits, see alignment E=1.8e-64

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0628)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJ45 at UniProt or InterPro

Protein Sequence (728 amino acids)

>SO0628 GGDEF domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSDGLANPLQQALVTIFSETPLETLEQNVDRALEAITLQLHCDGVFVLTGSLSLDHLRTR
NLYLKPQFTQGQQIRVWPLARMSFFRSLVRNPKLLNLPDVNTLPPEAQAERALLRDWDVK
SLLVLPPVVFGETRIALGAVNCSECCEWSEAFIQEFQHAAVMIGSAMELTRIAHDMLASE
NKYREVFNQLPLACALLDKQNQLMMLNKIALQTLPVQHGYDLFSMVREEEHAMLTDTLHM
VREGVLGQAWCELPLKSQHHLDWLRLSFSQIYGDKDTLVMIAEDVSEKYRLADELSFHAN
YDALTGLPNRLHFEALLENLLHAKDDMPTCVAFIDVDQFQVINNISGHQAGDKLLCQLAL
RLKQLVRKGDIVARLGGDEFGILMHYCNVDSAQHIAKRICTQLATHEFIWENRCHNVSVS
MGIAKFNRSASDIYAVMSHADAACRLAKDKGRNGWHLYSTKDPKMTRLYTEMMASVDIVS
ALALNQFELYFQSIAPLNYDESGLHLEVLLRMVQPNGNIVSPAIFLPAAERYNLAAKIDL
WVIDNLLKWGSNHLAIWQQLGLVSVNLSATSLGDSEFMNWLEMRLMTEPELVDKLCIEIT
ETAAVSQLDQATKLIEVLRPLNCQLALDDFGAGFSSFAYLKRLNVDYVKIDGQFVINLCE
DGADQAIVKAICQLGQDMGFDVVAEFVESTEIGLKLKSLGVDYAQGYAINKPTPLLTLTS
GLAESWLL