Protein Info for SO0605 in Shewanella oneidensis MR-1

Name: hflK
Annotation: hflK protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 52 to 74 (23 residues), see Phobius details PF12221: HflK_N" amino acids 1 to 40 (40 residues), 61.8 bits, see alignment 4.6e-21 TIGR01933: HflK protein" amino acids 71 to 331 (261 residues), 366.3 bits, see alignment E=4.5e-114 PF01145: Band_7" amino acids 73 to 245 (173 residues), 91.6 bits, see alignment E=5.9e-30

Best Hits

Swiss-Prot: 59% identical to HFLK_VIBCH: Protein HflK (hflK) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K04088, membrane protease subunit HflK [EC: 3.4.-.-] (inferred from 100% identity to son:SO_0605)

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJ67 at UniProt or InterPro

Protein Sequence (381 amino acids)

>SO0605 hflK protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MAWNEPGNKGNDPWGNKGGNDKGPPDLDEVFRNLSKRFGGNGNGSSGQNLSSFSLIIILA
IAFVVWGLSGLYTIKEAERGVALRFGQHNGEVGPGLHWKPTFIDEIYPVDVQSVRSVPSS
GSMLTSDENVVKVELDVQYRISDAYAYLFSAVDANASLREATDSALRYVIGHNKMDDILT
TGRDAIRRDTWKELERILEPYKLGLAIVDVNFLPARPPEEVKDAFDDAISAQEDEQRFIR
EAEAYAREIEPKARGEVERMAQQANAYKEREILEARGKVARFELLLPEYQAAPEVTRKRL
YLDAMQQVMTDTNKVIIDAKNNGNLMYLPLDKLMKEKPATMPDVEPKPQQNVNSSSIPTT
RIGEPLSGRPSREERARQGRE