Protein Info for SO0587 in Shewanella oneidensis MR-1

Annotation: glycerophosphoryl diester phosphodiesterase, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03009: GDPD
  • amino acids 6 to 221 (216 residues), 119.9 bits, E=1.1e-38

Best Hits

KEGG orthology group: K01126, glycerophosphoryl diester phosphodiesterase [EC: 3.1.4.46] (inferred from 100% identity to son:SO_0587)

Predicted SEED Role

"Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (EC 3.1.4.46)

MetaCyc Pathways

• glycerophosphodiester degradation (2/2 steps found)
• glycerol and glycerophosphodiester degradation (3/4 steps found)
• phosphatidylcholine resynthesis via glycerophosphocholine (1/2 steps found)
• phospholipid remodeling (phosphatidylethanolamine, yeast) (2/4 steps found)
• anandamide biosynthesis I (3/12 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.46

Sequence Analysis Tools

See Q8EJ81 at UniProt or InterPro

Protein Sequence (240 amino acids)

>SO0587 glycerophosphoryl diester phosphodiesterase, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MLIFAHRGASGYVAENTLAAMAKAIELGAKAIELDVHNVEGELVVFHDRRLDSKSSGTGI
IHLVSQDYLANVTVKGESISTLWQVLELVAGRATVNIELKGINTVAPLFKLYPKAIAELG
FSAEQLLISSFNHPYLQQVKQALPQALVAPLLASIPLDGAAVVSELNAYSLHLDVSFISK
VLVDDAHRRGAKVYVYTVDHSDDIHALKQLGVDGIFSNYPDRAMQALLQPTTTDYRGYFE