Protein Info for SO0566 in Shewanella oneidensis MR-1

Annotation: ABC 3 transport family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 164 to 189 (26 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details PF00950: ABC-3" amino acids 9 to 155 (147 residues), 21.8 bits, see alignment E=6e-09 amino acids 163 to 243 (81 residues), 35.5 bits, see alignment E=4e-13

Best Hits

KEGG orthology group: K02075, zinc/manganese transport system permease protein (inferred from 100% identity to son:SO_0566)

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJA2 at UniProt or InterPro

Protein Sequence (259 amino acids)

>SO0566 ABC 3 transport family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MFDLELMSILLPALAAGILVLSTHIVLGKQVLKRGIIFIDLAIAQVAALGAIVAHMDHRL
EEMPFSHVLMPALFALAGAGFIAWLSKRMAGELEAMIGCFYVLSAVAAMLLLANDPHGAE
LLKQLMSGQILWVSWSQLVLPTVVYVLVLAVIFVRPQILNGAGFYLLFALVITLSVELVG
VYLVFSTLILPALALNKYQGKNGLFYAYLVGLMGYLLGLVLSATMDLPSGAAIVATLAIS
ALVFRLGLSKAARVSHTQS