Protein Info for SO0544 in Shewanella oneidensis MR-1

Annotation: sensory box histidine kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 717 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details PF03924: CHASE" amino acids 89 to 273 (185 residues), 215.3 bits, see alignment E=2.4e-67 TIGR00229: PAS domain S-box protein" amino acids 356 to 480 (125 residues), 84.9 bits, see alignment E=2.6e-28 PF13188: PAS_8" amino acids 359 to 411 (53 residues), 34.1 bits, see alignment 6.5e-12 PF00989: PAS" amino acids 359 to 469 (111 residues), 61.6 bits, see alignment E=2.5e-20 PF08448: PAS_4" amino acids 365 to 476 (112 residues), 37.6 bits, see alignment E=7.9e-13 PF13426: PAS_9" amino acids 369 to 473 (105 residues), 46.1 bits, see alignment E=1.8e-15 PF00512: HisKA" amino acids 495 to 560 (66 residues), 41.6 bits, see alignment E=3.6e-14 PF02518: HATPase_c" amino acids 604 to 709 (106 residues), 74.6 bits, see alignment E=3.1e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0544)

Predicted SEED Role

"sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJC3 at UniProt or InterPro

Protein Sequence (717 amino acids)

>SO0544 sensory box histidine kinase (NCBI ptt file) (Shewanella oneidensis MR-1)
MDTDRFPESFGPPKSFFISVVRSSWLMLVAALTFMGISWFVLQEYLRERGEERFNNNVQE
LSEAVSRRMTAYEQVLRGGVGLFLSSRGVTRSEWQTYVANARLSDYYPGIQGLGFAELVT
PATLDEFTQQVQQEGFSDFRITPIGDRELYCVIKYLEPFDWRNQRAFGFDMCSEATRRSA
ILKAITSGLPKVSGKVTLVQETPENTQAGVLMYVPLYRGQPMTEVERMQQAIGVVYALFR
MNDLMQGIMGKRFSGIKLAIYDGSEANRTHLMFSSDPKLPSSKDVFYQSQLETMEGQVWR
IDVSSESRFISRAEQTRSVWLQVIGCAFILALFYAVISMARNRYQESMLTAELIANEKRF
RLIIEASPSALFMVDKTGVITLVNTQGERLFGYTREELLGRSINMLLPETLREIHQQHLS
HYLVHPIAKNMSMRDDLLGCCKDGTPLAVEVGLTPVHFSNGIYILTTINNISERKRIEAQ
RIEHMAELERINQELDRFAYIASHDLKSPLRGIEQLTTWLSEDLVDNTNENVQKYLGLIQ
NRIQRMVRLLDGLLTFSRIGRVDNEMVEVDSRQLVEDMFALVAPPQGFELVLEGDFPHFK
TVKTLLELVVRNLISNAIKHHDRGFGVLKVLCETKNTYYWFSVVDDGPGISSEFQLKVFE
MFQTLRPRDEVEGSGLGLSLVKKTVDSLGGKIQLESVGRGCCFRFSWPIHIVNKEGI