Protein Info for SO0541 in Shewanella oneidensis MR-1

Annotation: metallo-beta-lactamase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 PF00753: Lactamase_B" amino acids 12 to 117 (106 residues), 38.1 bits, see alignment E=4e-13 PF16661: Lactamase_B_6" amino acids 19 to 184 (166 residues), 28.6 bits, see alignment E=2.2e-10 PF10996: Beta-Casp" amino acids 254 to 380 (127 residues), 117.3 bits, see alignment E=1.4e-37 PF07521: RMMBL" amino acids 394 to 445 (52 residues), 59.2 bits, see alignment 8.1e-20

Best Hits

KEGG orthology group: K07576, metallo-beta-lactamase family protein (inferred from 100% identity to son:SO_0541)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJC6 at UniProt or InterPro

Protein Sequence (478 amino acids)

>SO0541 metallo-beta-lactamase family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTLQFLGAAREVTGSCHLVTVAGKHLLLDCGLIQGGKADELRNHEPFVFDPQTIVAVVLS
HAHIDHSGRLPLLVKAGFDGPIYTHKATAELCAIMLKDAAMLQVRDTERTNKKRAKHDLA
PLEPLFTVEDAEQAISQFVSLEYGQVTRVIPHVDICLSDAGHILGSALVELWLGEGKSQK
KIVFSGDLGRAGMPILQNPTLVDTADLVLMESTYGNRFHRSWTDTLAELKDIFAKTVNES
QGNILLPAFSVGRAQELLYLFHLYAKEWDLGRWKICLDSPMAIEATRVYVNNYPLMDEDF
KRFTRQHPGQHPLLSNVEFIQTTEESIALNEVHKGLIIIAGSGMCNGGRIRSHLEHNLWR
SECDVIICGFQALGTPGRALVDGAKELTIHGNSVNVAAKLHTVGGLSAHADQAELLRWYR
HFEEQPPLVLVHGEPEAQQGLVAVMNQDPKTKPKALAIATRGDMLDLTALPKLVWVTA