Protein Info for SO0539 in Shewanella oneidensis MR-1

Annotation: transporter, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 53 to 77 (25 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 172 to 203 (32 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 303 to 326 (24 residues), see Phobius details amino acids 332 to 355 (24 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details amino acids 391 to 413 (23 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 286 (262 residues), 56.9 bits, see alignment E=8.9e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0539)

MetaCyc: 70% identical to 1-arseno-3-phosphoglycerate exporter (Pseudomonas aeruginosa)
TRANS-RXN1YI0-17

Predicted SEED Role

"Permease of the major facilitator superfamily"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJC8 at UniProt or InterPro

Protein Sequence (420 amino acids)

>SO0539 transporter, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MSAAKPFEQLMQLPAAVRQYLLITFNYWSFTLTDGALRMLVVLHFHQLGYSPLAIAMLFL
FYEIFGVVTNLLGGYLGARLGLNRTMNMGLGMQVFALAMLLVPAASLPLWLAGVPWVMAA
QALSGVAKDLNKMSAKSAIKLLVPKGEQGKLYQWVALLTGSKNALKGAGFFLGGMLLALF
GFELAIAMMASLLGLVWLLSVVMLKKDLGKAKNQPKFTEIFSKSRSVNILSAARLFLFAA
RDAWFVVALPVYLASKFAWDHWAVGGFLALWVIGYGIVQTLAPKITGNQHQGLGVGAAPD
GCSALIWASILAFVPALIACAMQFSFYPEASLLLGLMLFGVLFAVNSSLHSYLIVSYASE
DAVSLDVGFYYMANAMGRLVGTVLSGLVYQAYGLAACLWISSIFIGITAVISIKLPRQVA