Protein Info for SO0530 in Shewanella oneidensis MR-1

Annotation: transporter, LysE family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 61 (25 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 143 to 168 (26 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details PF01810: LysE" amino acids 13 to 201 (189 residues), 97.2 bits, see alignment E=4.4e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0530)

Predicted SEED Role

"Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJD7 at UniProt or InterPro

Protein Sequence (203 amino acids)

>SO0530 transporter, LysE family (NCBI ptt file) (Shewanella oneidensis MR-1)
MELLSIVIFGLLIVVSPSADFVLVFKNSAMHSRKAGMLTAIGIGAGVCVHISYSIIGISQ
LIANNAGLFSLVKYVGAAYLIYIGIAGLLSAKLTLDYGTQLIKPVENRKYIMQGFLCNVL
NPKTMIFFLSVFSQLISSHSDSLAFVISYGVYIAVLHGIWFCIVAYLVTSAKATRVLKRF
GHRINQACGVGLITFGVILSTND