Protein Info for SO0477 in Shewanella oneidensis MR-1

Name: nrfF
Annotation: cytochrome c-type biogenesis protein NrfF precursor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 114 to 135 (22 residues), see Phobius details PF03918: CcmH" amino acids 33 to 144 (112 residues), 116.6 bits, see alignment E=2.7e-38

Best Hits

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 100% identity to son:SO_0477)

Predicted SEED Role

"Cytochrome c-type heme lyase subunit nrfF, nitrite reductase complex assembly" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8CVD6 at UniProt or InterPro

Protein Sequence (149 amino acids)

>SO0477 cytochrome c-type biogenesis protein NrfF precursor (NCBI ptt file) (Shewanella oneidensis MR-1)
MNPLFRSPYLCLLFWLLSLALCFGGATFLATAQEGPNMGASYQQQAIAISKELRCPMATN
QTLFESQAPIAHELKGQIFSLLEQGYKRDEVLDFMVQRYGEKIRYQPEFKPSTMALWLGP
LVLLVAGLGLGLTLIKRKSASPDKATRSV