Protein Info for SO0456 in Shewanella oneidensis MR-1

Annotation: immunogenic-related protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02122: TRAP transporter solute receptor, TAXI family" amino acids 3 to 316 (314 residues), 392.7 bits, see alignment E=5.1e-122 PF16868: NMT1_3" amino acids 32 to 316 (285 residues), 327.7 bits, see alignment E=1.2e-101 PF09084: NMT1" amino acids 91 to 193 (103 residues), 31.4 bits, see alignment E=2.8e-11 PF12974: Phosphonate-bd" amino acids 114 to 191 (78 residues), 29.5 bits, see alignment E=7.1e-11

Best Hits

KEGG orthology group: K07080, (no description) (inferred from 100% identity to son:SO_0456)

Predicted SEED Role

"TRAP transporter solute receptor, unknown substrate 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJK7 at UniProt or InterPro

Protein Sequence (318 amino acids)

>SO0456 immunogenic-related protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKINKRFIAVSAALTLSLSAATMAAAPAFINILTGGTSGVYYPIGVALSQLYGTGIEGAK
TSVQATKASVENLNLLQAGRGELALALGDSVAAAYQGDADAGFKKPLDKVRVLAAAYPNY
IQIVASKESGIKTLADLKGKRISVGAPKSGTELNARAIFKAAGLSYEDMGKVEFLPYAES
VELIKNRQLDATLQSSGLGMAAIRDLATTMPINFVEVPEDVILKINNPAYQHGVIPASTY
EGQTADVSTVAIQNLFVTQTGVSDDLAYQMTKLMFEHLDRLGNAHSAAKAIQLDKATKNL
PAPLHPGAERYFKEVGAL