Protein Info for SO0455 in Shewanella oneidensis MR-1

Annotation: hypothetical transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 677 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details amino acids 394 to 427 (34 residues), see Phobius details amino acids 448 to 480 (33 residues), see Phobius details amino acids 486 to 504 (19 residues), see Phobius details amino acids 511 to 556 (46 residues), see Phobius details amino acids 566 to 586 (21 residues), see Phobius details amino acids 597 to 623 (27 residues), see Phobius details amino acids 633 to 661 (29 residues), see Phobius details TIGR02123: TRAP transporter, 4TM/12TM fusion protein" amino acids 16 to 669 (654 residues), 810.9 bits, see alignment E=4.5e-248 PF06808: DctM" amino acids 112 to 376 (265 residues), 206.8 bits, see alignment E=2.6e-65 amino acids 389 to 592 (204 residues), 87.2 bits, see alignment E=5.5e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0455)

Predicted SEED Role

"TRAP transporter, 4TM/12TM fusion protein, unknown substrate 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJK8 at UniProt or InterPro

Protein Sequence (677 amino acids)

>SO0455 hypothetical transporter (NCBI ptt file) (Shewanella oneidensis MR-1)
MSDSEQGLSANTSDWPKALFYSALIFSIFQIITAAFHPVSTQVLRATHVGFLLLVVFLSY
PAVGKSRPWQPLAWLLGLAGMATAAYQWIFEADLIQRSGELTDADMVMGIILIVLVFEAA
RRVMGWALPIICCIFLAYGLFGQYLPGDLMHRGYGVDQIINQLSFGTEGLYGTPTYVSAT
YIFLFILFGAFLEQAGMIRLFTDFAMGLFGHKLGGPAKVAVVSSALMGTITGSGVANVVT
TGQFTIPLMKRFGYRPAFAGGVEATSSMGSQIMPPIMGAVAFIMAETINVPFIEIAKAAL
LPALLYFCSVFWMVHLEAKRANLCGLPKDQCPDPWAAVKARWYLLIPLFILVYLLFSGRT
PLFSGMVGLALTSIVILGSAIVLRLPSNALRFAFWIALGVLCAGFFQMGIGVVFGVIAIL
VAICWFIKGGKDTLTICLHALVEGARHAVPVGIACALVGVIIGIVSLTGIASTFASYILA
VGQDNLFLSLVLTMITCLVLGMGIPTIPNYIITSSIAAPALLDLGVPLIVSHMFVFYFGI
MADLTPPVALACFAAAPIAKESGFKISLWAIRIAIAGFVIPFMAVYDPALMLQSDSWLAT
IYVLIKVTVAIGIWGVVFTGYLLQKLYLWERVIGFLAGGSLILATPLSDEIGFGLALLFI
VQHSLRARKLKRLAAQG