Protein Info for SO0438 in Shewanella oneidensis MR-1

Annotation: oxidoreductase, short chain dehydrogenase/reductase family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF00106: adh_short" amino acids 7 to 195 (189 residues), 176.3 bits, see alignment E=7.8e-56 PF08659: KR" amino acids 9 to 165 (157 residues), 45.8 bits, see alignment E=1e-15 PF13561: adh_short_C2" amino acids 13 to 197 (185 residues), 122.1 bits, see alignment E=4.3e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0438)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJM5 at UniProt or InterPro

Protein Sequence (267 amino acids)

>SO0438 oxidoreductase, short chain dehydrogenase/reductase family (NCBI ptt file) (Shewanella oneidensis MR-1)
MDGLTGKVVIITGASEGIGRALAIAMARIGCQLVLSARNETRLASLALEVANYGPTPFVF
AADVSSASQCEDLIHATIAHYGRIDILVNNAGMTMWSRFDELTQLSVLEDIMRVNYLGPA
YLTHAALPYLKSSQGQVVIVASVAGLTGVPTRSGYAASKHAVIGFFDSLRIELADDNVAV
TVICPDFVVSQIHKRALDGAGKPLGKSPMQEAKILSAEQCANMMLPVIATRGRLLITSLR
GRLGRWLKLIAPGLIDKIARKAIASGR