Protein Info for SO0437 in Shewanella oneidensis MR-1

Annotation: sensory box protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 856 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details PF08448: PAS_4" amino acids 311 to 418 (108 residues), 34.3 bits, see alignment E=4.7e-12 PF00989: PAS" amino acids 311 to 414 (104 residues), 30.4 bits, see alignment E=6.8e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 424 to 584 (161 residues), 104.4 bits, see alignment E=5.4e-34 PF00990: GGDEF" amino acids 428 to 581 (154 residues), 122.4 bits, see alignment E=3.2e-39 PF00563: EAL" amino acids 604 to 838 (235 residues), 204.2 bits, see alignment E=4.2e-64

Best Hits

Swiss-Prot: 100% identical to PDEB_SHEON: Cyclic di-GMP phosphodiesterase PdeB (pdeB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to son:SO_0437)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJM6 at UniProt or InterPro

Protein Sequence (856 amino acids)

>SO0437 sensory box protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MRIGNKILVFIVGFCLPAVVLVSYCLGVWFDHRVELLRQDNVRHELANIQQQFRIDVDRL
GFLTNIYASPLSHLDSEQLKSLESSWLESSMSGNLSWFILRDGNLQNVFQNEQPIAEANR
QEIAKAITTQAKPEFASAYLIGDKGYVVTAVASHLGEYVLLVRQLTERDLLEYAQTSLVA
RVSMSNVVTAHHSSHSSSVALPSLISQQPIYLHVEFSDDPFRDVKLSLDWVSLAVILLGI
LIVALGYVWLRACLLQPFKSLMQQLALVDPMASVYRPVTSEGNEELSVLANRVNSLLARI
YQQKERGKITLESIAEAVILTDIEAKVIYMNPKAETLLEVASSNAVGESLASLLKAGEQL
NQAVFHCIRLGETMPQVAKIKLLTTMPRIIERSISNVLNHEKEIVGTVVVLRDITQEELL
KHQLQKRANFDGITGLLNRQAFEEQLPEFASQARSLAVCYLDLEQFKLINDSCGHTAGDR
MLAMVARAIQSCLGPQELLARIGGDEFGLVICDRTALAVAQLLKQIIAQVSLQVLHDKNC
NYKVGLSIGVAFGRAPYINAQELLKDADIACIAAKAKGTNQIHIYDDKDKELTYQRNAPK
WAVRIAQAIEENELLLYYQPIRGLGASSKRQRMEVLLRIQEPCGRILAPAQFIAAAERFK
LMPEIDKEVIRKAFLWLSLNSQLWQDHCISINLSGNSLGAEGMVEYIAKQQQIFDIPSQC
VCFEITETTAIQNRHRGMEMLRQLRKLGFSFALDDFGSGFASYGYLRELPVDYVKIDGCF
VKNLAVNAKDYAIVKSIQDVCRVMGIETVAEFVENQEIIDRLQTIGINYAQGYAIGRPQP
LASYCEQFETRLAQRA