Protein Info for SO0435 in Shewanella oneidensis MR-1

Name: hemE
Annotation: uroporphyrinogen decarboxylase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01208: URO-D
  • amino acids 5 to 347 (343 residues), 470.7 bits, E=1.3e-145
• TIGR01464: uroporphyrinogen decarboxylase
  • amino acids 9 to 346 (338 residues), 443.7 bits, E=2e-137

Best Hits

Swiss-Prot: 100% identical to DCUP_SHEON: Uroporphyrinogen decarboxylase (hemE) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01599, uroporphyrinogen decarboxylase [EC: 4.1.1.37] (inferred from 100% identity to son:SO_0435)

MetaCyc: 81% identical to uroporphyrinogen decarboxylase (Escherichia coli K-12 substr. MG1655)
Uroporphyrinogen decarboxylase. [EC: 4.1.1.37]

Predicted SEED Role

"Uroporphyrinogen III decarboxylase (EC 4.1.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.1.1.37)

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (10/10 steps found)
• superpathway of heme b biosynthesis from uroporphyrinogen-III (6/6 steps found)
• superpathway of heme b biosynthesis from glycine (7/8 steps found)
• heme b biosynthesis I (aerobic) (4/4 steps found)
• heme b biosynthesis II (oxygen-independent) (4/4 steps found)
• heme b biosynthesis V (aerobic) (4/4 steps found)
• heme b biosynthesis IV (Gram-positive bacteria) (1/5 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (3/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis II (anaerobic) (3/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (3/9 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.37

Sequence Analysis Tools

See Q8EJM8 at UniProt or InterPro

Protein Sequence (354 amino acids)

>SO0435 uroporphyrinogen decarboxylase (NCBI ptt file) (Shewanella oneidensis MR-1)
MAELKNDRYLRALLKQPVDMTPVWMMRQAGRYLPEYKATRAQAGDFMSLCKNHELACEVT
LQPLRRYELDAAILFSDILTVPDAMGLGLYFEAGEGPRFERPTDTIDAIKKLSIPDPEDE
LGYVMKAVSTIRRELNGQVPLIGFSGSPWTLATYMVEGGSSKTFEKIKKMAYAEPAALHM
LLDKLADSVTLYLNAQVANGAQSLMIFDSWGGALSHTAYREFSLRYMQKIVDGLTRFADG
RQVPVTLFTKGGGLWLEAMAETGCDALGLDWTVDIADARRRVGHKVALQGNMDPSMLYAP
IPRIEEEVGQILAGYGEGTGHVFNLGHGIHQHVDPEHAGAFIKAVHAQSKQYHK