Protein Info for SO0431 in Shewanella oneidensis MR-1

Annotation: HAD-superfamily hydrolase, subfamily IA, variant 3 protein family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF00702: Hydrolase" amino acids 6 to 183 (178 residues), 99.9 bits, see alignment E=3.8e-32 PF13419: HAD_2" amino acids 9 to 189 (181 residues), 107.2 bits, see alignment E=1.7e-34 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 91 to 188 (98 residues), 46 bits, see alignment E=6.2e-16 PF13242: Hydrolase_like" amino acids 144 to 189 (46 residues), 29.8 bits, see alignment 6.7e-11

Best Hits

Swiss-Prot: 45% identical to HXPB_ECO57: Hexitol phosphatase B (hxpB) from Escherichia coli O157:H7

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to son:SO_0431)

MetaCyc: 45% identical to hexitol phosphatase B (Escherichia coli K-12 substr. MG1655)
2-deoxyglucose-6-phosphatase. [EC: 3.1.3.68]; Sorbitol-6-phosphatase. [EC: 3.1.3.68, 3.1.3.50]; Mannitol-1-phosphatase. [EC: 3.1.3.68, 3.1.3.50, 3.1.3.22]

Predicted SEED Role

"2-deoxyglucose-6-phosphate hydrolase YniC" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.22 or 3.1.3.50 or 3.1.3.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJN2 at UniProt or InterPro

Protein Sequence (217 amino acids)

>SO0431 HAD-superfamily hydrolase, subfamily IA, variant 3 protein family (NCBI ptt file) (Shewanella oneidensis MR-1)
MTSLSIQAVIFDMDGVLIDSEPLWQRVEYEVLSALGVPVTLETIQQTTGLRIDQCVDYWY
HKAPWADYDNAKVSKTIVDKVAEEILQTGEPMPGVQQAMAYCQAKGLKIGLATSSPTVLI
DAVLARLKLKGQFMAVESAEALTYGKPHPEVYLNCATALGVDPRYCLAIEDSFNGIIAAR
AANMQTVAIPAPEQRGETKWIVAHHQLESLFQLNKVL