Protein Info for SO0415 in Shewanella oneidensis MR-1

Annotation: type IV pilus biogenesis protein PilC (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 90 to 108 (19 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 340 to 358 (19 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details PF00482: T2SSF" amino acids 88 to 210 (123 residues), 115.9 bits, see alignment E=5.9e-38 amino acids 291 to 413 (123 residues), 108.6 bits, see alignment E=1e-35

Best Hits

Swiss-Prot: 62% identical to TAPC_AERHY: Type IV pilus assembly protein TapC (tapC) from Aeromonas hydrophila

KEGG orthology group: K02653, type IV pilus assembly protein PilC (inferred from 100% identity to son:SO_0415)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJP7 at UniProt or InterPro

Protein Sequence (423 amino acids)

>SO0415 type IV pilus biogenesis protein PilC (NCBI ptt file) (Shewanella oneidensis MR-1)
MATATTVKKPRPKKIEQKSQPKIYTFEWKGVNRDGQKTSGELRGASAAEIRSQLKSQGVN
PKTVRKQSAALFKLGDPKITPMDIAMVTRQIATMLAAGVPLVTTIELLGRGHEKVKMREL
LATILSEIQSGIPLSDALRPHRRYFDDLYVDLVAAGEHSGSLDVVFDRIATYREKSEALK
SKIKKAMFYPAAVVIVAILVTALLLLFVVPQFEDIFKGFGAELPAFTQLVLQISRGLQSS
WYIFLGAIVAGVFLFVRAHRNSQIVRDRVDEAVLKIPAIGPILHKGAMARFARTLATTFA
AGVPLIDGLESAAGASGNAVYRKAILKIRQEVMAGMQMNVAMRTTGLFPDMLIQMVMIGE
ESGSLDNMLNKVSTIYEMQVDDAVDGLSSLIEPIMMVVIGTVVGGLIVAMYLPIFQMGKV
VGG