Protein Info for SO0383 in Shewanella oneidensis MR-1

Name: hsdM-1
Annotation: type I restriction-modification system, M subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 transmembrane" amino acids 345 to 364 (20 residues), see Phobius details PF12161: HsdM_N" amino acids 1 to 121 (121 residues), 86.2 bits, see alignment E=4.9e-28 TIGR00497: type I restriction-modification system, M subunit" amino acids 2 to 453 (452 residues), 251.6 bits, see alignment E=7.7e-79 PF02384: N6_Mtase" amino acids 134 to 440 (307 residues), 363.9 bits, see alignment E=1.1e-112 PF07669: Eco57I" amino acids 230 to 347 (118 residues), 34.5 bits, see alignment E=3.3e-12

Best Hits

KEGG orthology group: K03427, type I restriction enzyme M protein [EC: 2.1.1.72] (inferred from 100% identity to son:SO_0383)

Predicted SEED Role

"Type I restriction-modification system, DNA-methyltransferase subunit M (EC 2.1.1.72)" in subsystem Restriction-Modification System (EC 2.1.1.72)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJS9 at UniProt or InterPro

Protein Sequence (585 amino acids)

>SO0383 type I restriction-modification system, M subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MDASEFKDYIFGMMFLKRLSDSFDEAREQVFEYYLAKGKTQVEAEALASDEDEYDSTFYI
PEVARWSALKDLKHNIGEALNTAAEAIEEHNPNLEGVLVSIDFNIKNKLSDNKLRDLLSH
FNKYRLRNSDFERPDLLGTAYEYLIKMFADSAGKKGGEFYTPSEVVQLLVALLKPHAGMR
IYDPTAGSGGMLIQMRNYLATHNENAANLSLYGQEMNLNTWAICKMNMFLHGVQSADIRK
GDTLREPKHTIDGSLMTFDRVIANPPFSLSKWGKEDCDKDKYGRFPYGTPPKDSGDLAFV
QHMIASTNDDGMVGVVMPHGVLFRGSSEKDIRKGILEDDLLEAVISLPSGLFYGTGIPAC
LLIINKQKPSERQGKVLFIYAELEYHEGKNQNSLRPQDINKIVTTFDSFSEIKRYSAVVK
LKDIRDNDYNLNIRRYADTSPPAEIFDVRAILHGGIPVREVENDYIQEEILKGFDVSCVF
EPKLNHASQSTDQQYYQFKAEITTKEQIRPLVENSVEQVKAIEDCATDNSAEQTSTTELA
SVTLIVGQFERWWDKYQVSLHQLDAEMAEAEQVMQGYLKELGYES