Protein Info for SO0362 in Shewanella oneidensis MR-1

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 transmembrane" amino acids 38 to 55 (18 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0362)

Predicted SEED Role

"FIG01056976: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJU5 at UniProt or InterPro

Protein Sequence (516 amino acids)

>SO0362 hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MPIRHLRSCALGLFHYKGRVVLLKSLFCLHGRDSRPRFVAISVGVYLGISLAVAAFGANF
LMYLLALVGLPLLSLTALRRLTDAAKPKALVVVLILPLIVLLALHIVAAPPVLAMLGLVL
GAGATFWGARFSSPTLVDYRFGYYGPAFDTPTSQAIPRRRVEPVITPKAAAAQNAAPNAS
VDVPVTAPVVADTHAEPTIAPSVTAPELEVLRQDELRFDALTKMTANPADFVVPDTVVEG
HADFHPANKGRVEQARIDIADVDRVQVNLPDEDVKRAPLDAEQRDEPVWRFDPNDDAEVF
NDTEHAEEVRRRRAEAKESGSMTELFRGVAEFFAPYRRYIKLPKLPKLERRYWLPVGGGA
GAVLLVLLVWGLWPSSDESPAEEAVPSVPSAPIAASDRVTLDLPDGFSVALEQDVLIIRW
LGEQGKPQNLWSIATAKGDKSCSALVFNNGTEYRTITVDLLADSATEARFTPLDTASIIT
DLARRGSIGLCGYKFSLKGSQAVLEPNRAFGTYLAR