Protein Info for SO0360 in Shewanella oneidensis MR-1

Name: rpoZ
Annotation: DNA-directed RNA polymerase, omega subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00690: DNA-directed RNA polymerase, omega subunit
  • amino acids 1 to 60 (60 residues), 86.7 bits, E=4.3e-29
• PF01192: RNA_pol_Rpb6
  • amino acids 8 to 59 (52 residues), 65.8 bits, E=1.4e-22

Best Hits

Swiss-Prot: 100% identical to RPOZ_SHEON: DNA-directed RNA polymerase subunit omega (rpoZ) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03060, DNA-directed RNA polymerase subunit omega [EC: 2.7.7.6] (inferred from 99% identity to she:Shewmr4_3614)

Predicted SEED Role

"DNA-directed RNA polymerase omega subunit (EC 2.7.7.6)" in subsystem RNA polymerase bacterial (EC 2.7.7.6)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

See Q8EJU7 at UniProt or InterPro

Protein Sequence (92 amino acids)

>SO0360 DNA-directed RNA polymerase, omega subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MARVTVEDAVEQIGNRFDMILVAARRARQIAVQGKDPMVEEMNDKPTVIALREIELGLVN
AHTLDADERQTVREREAAEIAAVAAIAEGRSL