Protein Info for SO0349 in Shewanella oneidensis MR-1

Annotation: magnesium chelatase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 TIGR00368: Mg chelatase-like protein" amino acids 6 to 495 (490 residues), 634.5 bits, see alignment E=5.7e-195 PF13541: ChlI" amino acids 21 to 142 (122 residues), 158.7 bits, see alignment E=1.9e-50 PF05362: Lon_C" amino acids 40 to 147 (108 residues), 21.4 bits, see alignment E=5.8e-08 PF01078: Mg_chelatase" amino acids 194 to 393 (200 residues), 295 bits, see alignment E=8.7e-92 PF00493: MCM" amino acids 290 to 386 (97 residues), 30.6 bits, see alignment E=6.7e-11 PF13335: Mg_chelatase_C" amino acids 403 to 495 (93 residues), 94.9 bits, see alignment E=1.3e-30

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 100% identity to son:SO_0349)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJV7 at UniProt or InterPro

Protein Sequence (508 amino acids)

>SO0349 magnesium chelatase family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MAIACVHTRASCGVEAPEVTVEVHLSNGLPAFNLVGLPEASVKEARERVRSALINAGFEF
PMRRITVNLAPADLPKQGGRYDLPIAIGILAASEQIPATSLKDTEFVGELALSGQIRYCQ
GLLPAIIAAKRQNNQLILPLENRHDAELVGYPKVYFGSHLQSLAAFLHGQAPLPMLEQQL
EWISNEPVESTPCLSEVIGQYQAKQALEIAAAGNHNLLMLGPPGTGKTMLASRMMALLPA
LNYEEALEVAAIHSVAGINIKPQDFLKRPFRAPHHTCSSISLVGGGSIPKPGEISLAHRG
VLFLDEVAEFPRKVLDCLREPMETGEVVISRAAAKLTFLSRFQLIAAMNPSPSGDIDGPN
RATPDQIQRYLARLSGPFIDRFDLTIEVPKLPAGTLTQQSAQGETSHQIAKRVKCARDIQ
LARAGVLNSELSGKQLKQFSGLTDTDLSFLEQSVVKLGLSVRSFHRIQRVARTIADLEQA
PNTERRHLAQALGYRAMDKLLARLSQQY