Protein Info for SO0347 in Shewanella oneidensis MR-1

Annotation: acyltransferase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details PF01553: Acyltransferase" amino acids 65 to 203 (139 residues), 43.7 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 43% identical to YIHG_ECOLI: Probable acyltransferase YihG (yihG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to son:SO_0347)

MetaCyc: 43% identical to 1-acylglycerol-3-phosphate O-acyltransferase YihG (Escherichia coli K-12 substr. MG1655)
1-acylglycerol-3-phosphate O-acyltransferase. [EC: 2.3.1.51]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.51

Use Curated BLAST to search for 2.3.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJV9 at UniProt or InterPro

Protein Sequence (302 amino acids)

>SO0347 acyltransferase family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLSLSLLIINTALWGSLVCLGGLVKMLMPVQSARNAVTALMNRFMWAWATCNGGILYLIA
KIEWDVEGLESLNQNSWYLLISNHLSGFDIAAQTYLLRNHIPMLKFFLKKELIYVPIMGL
GCWALDMPFMDRTSPAKLKKNPKLKGKDLATTRRACEKFKNMPTSIINYVEGSRFTEDKR
QRQDSPYRHLLRPKAGGIAFTLSAMGEQFTNLLDVTLVYPDAPDDVLFGVMNGKVRKIIV
RVRALPVPQVDATRYFSESEYRVDFQRWLNQVWAEKDEQITELLAQHQQLTDSATSARTQ
AH