Protein Info for SO0336 in Shewanella oneidensis MR-1

Annotation: hypothetical Na+/H+ antiporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 52 (25 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 365 to 393 (29 residues), see Phobius details amino acids 405 to 422 (18 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details amino acids 475 to 496 (22 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 161 to 468 (308 residues), 142.8 bits, see alignment E=7.5e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0336)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJX0 at UniProt or InterPro

Protein Sequence (507 amino acids)

>SO0336 hypothetical Na+/H+ antiporter (NCBI ptt file) (Shewanella oneidensis MR-1)
MLSNLLAILPLFLTLVLALWLRRTLVALGVGILSGALIIAHFDIVQSVSYLLEIGVKQFY
SQDAWQWWHLNVLTAMLLLGSMTQLLARSGAVGLFGDWLYRRIRTGRQARVGVVLLGWLV
FIDGIFSCLAVGHVCQPLSQRYGIRQEQLAYLVDSNASPLCSLLPFSSWGPYVMALLAGL
SFLPVSALEAFIEVALSNFYAITTLGLSLIVAWFGVGFRPIESAVLMAAEPSKVTQMDIA
PPSSQGNPWLLAIPMLTLLCASVGLTLWSGAQQVPAWDISAWLASADIGAAMRDACLLST
LVTLGLLIMSGRSIGKLLGDLAHGVRMIAFAIAILLCTWMIGAVIQDLGVASLLADWAKW
YLSPSLLVAGMFLLCAIMAFATGSSWGTFAIMIPIGGEIAHNMDASLLLPVLSAVMAGSV
FGDHCSPISDTSVLSATSSGCLPHDHVVTQLPFALIAAFAALVGFQLVNLSVATVFVWLG
VIGTSLGLLVLMARFYPPWVAARSQTN