Protein Info for SO0320 in Shewanella oneidensis MR-1

Annotation: conserved domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 140 to 157 (18 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 296 to 321 (26 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 1 to 313 (313 residues), 97.9 bits, see alignment E=3.1e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0320)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJY6 at UniProt or InterPro

Protein Sequence (335 amino acids)

>SO0320 conserved domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MRGIAIIFIVLGHSIYNSGEGFPVLLENLLRGGTALFVFISGYFFHRIFYKDFDYGKFMK
NKVQNVLYPFLFVSIVGLFCLSLRWVFMEHQSLEQVLLSIFYTVRNGYILYPHWYIPFIM
AVFLFSPVFLWFIRCSQQMRWTLFVLSCVVAILLHRPIGNVNFIHSVVYYLPFYLIGILY
SQDEHIVTRYGSILSALAGIFLVVSLVEQSYIVQHVGNYHKAPFEYNGIDWQFIQKLSLC
VLVLNFCDWLSQRSRLPWLIETAEMSFAIFFIHPLFDMLFNTTATIFRYRFPPDSWVTSI
LFSFGIFLFLMVSSMMTARLIKKRLGNRSRLFIGW