Protein Info for SO0313 in Shewanella oneidensis MR-1

Name: potE
Annotation: putrescine-ornithine antiporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 223 to 248 (26 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details amino acids 350 to 373 (24 residues), see Phobius details amino acids 385 to 403 (19 residues), see Phobius details amino acids 409 to 427 (19 residues), see Phobius details TIGR00905: transporter, basic amino acid/polyamine antiporter (APA) family" amino acids 1 to 430 (430 residues), 441.2 bits, see alignment E=4.9e-136 TIGR04299: putrescine-ornithine antiporter" amino acids 5 to 430 (426 residues), 752.2 bits, see alignment E=2e-230 PF13520: AA_permease_2" amino acids 8 to 403 (396 residues), 165.2 bits, see alignment E=2.5e-52 PF00324: AA_permease" amino acids 13 to 411 (399 residues), 75.9 bits, see alignment E=2.9e-25

Best Hits

Swiss-Prot: 74% identical to POTE_ECOL6: Putrescine transporter PotE (potE) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03756, putrescine:ornithine antiporter (inferred from 100% identity to son:SO_0313)

MetaCyc: 74% identical to putrescine transporter PotE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-69; TRANS-RXN0-211

Predicted SEED Role

"Putrescine/proton symporter, putrescine/ornithine antiporter PotE" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EJZ3 at UniProt or InterPro

Protein Sequence (439 amino acids)

>SO0313 putrescine-ornithine antiporter (NCBI ptt file) (Shewanella oneidensis MR-1)
MSKSENKIGVVQLTIITIVNMMGSGIIMLPTQLAQVGTISVLSWLVTAAGSTALAFAFAK
CGMFSKKSGGMGGYAEYAFGRSGNFMANYTYAVSLLIANVAIAISAVGYAAVLLEVNLSP
MAICLATIGVLWLATVANFGGARITGRVSSVTVWGIILPVIGVSLIGWFWFDIDLYKGAW
NPHDMPFFKALGGSIAMTLWAFLGLESACANSEAVDNPEKNVPIAVMGGTLGAALIYIVS
TNVIAGIVPNAELASSNAPFGLAFAQMFNPVVGKIVMACAIISCTGSLLGWQFTIAQVFK
ASADEGFFPKVFAKVSKADAPIWGMTIIVSIQTLLSLMTISPSLSKQFEALVNLAVVTNI
VPYILSMAALGVMQKQLKVPANKARVANVIAVIGALYSFYALYSSGETAVMLGAIATFFG
WTIYGVISNKTPSVEIKAA