Protein Info for SO0298 in Shewanella oneidensis MR-1

Name: gmhA
Annotation: phosphoheptose isomerase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13580: SIS_2
  • amino acids 9 to 144 (136 residues), 116.9 bits, E=7.1e-38
• PF01380: SIS
  • amino acids 86 to 152 (67 residues), 30.7 bits, E=2.5e-11

Best Hits

Swiss-Prot: 100% identical to GMHA_SHEON: Phosphoheptose isomerase (gmhA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K12961, DnaA initiator-associating protein (inferred from 99% identity to sbn:Sbal195_4189)

MetaCyc: 46% identical to D-sedoheptulose 7-phosphate isomerase (Aneurinibacillus thermoaerophilus)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

• ADP-L-glycero-β-D-manno-heptose biosynthesis (4/5 steps found)
• GDP-D-glycero-α-D-manno-heptose biosynthesis (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Galactose metabolism
• Inositol phosphate metabolism
• Pentose and glucuronate interconversions

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.- or 5.3.1.28

Sequence Analysis Tools

See Q8EK08 at UniProt or InterPro

Protein Sequence (197 amino acids)

>SO0298 phosphoheptose isomerase (NCBI ptt file) (Shewanella oneidensis MR-1)
MLERIKDSFTESIQTKIDAAEALPESIAKAAEMMVQCLLGGNKILACGNGGSAGDAQHFS
AELLNRYEIERPPLPAIALSTDTSTITAIANDYSYDEIFSKQILALGQPGDILLAISTSG
NSGNVIKAMEAALSRDMTIVALTGKDGGAMAGLLSVGDVEIRVPSNVTARIQEVHLLVIH
CLCDNIDRTLFPQDEQQ