Protein Info for SO0297 in Shewanella oneidensis MR-1

Annotation: lipoprotein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF04972: BON" amino acids 43 to 111 (69 residues), 44.3 bits, see alignment E=8.8e-16 amino acids 121 to 186 (66 residues), 63.1 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 40% identical to Y1658_HAEIN: Uncharacterized protein HI_1658 (HI_1658) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to son:SO_0297)

Predicted SEED Role

"21 kDa hemolysin precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EK09 at UniProt or InterPro

Protein Sequence (188 amino acids)

>SO0297 lipoprotein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MRYAAPLLMVCMLLQGCAGAVMVGAVSGAMMANDERSVKTQLDDTNTDFKITSALLEHED
LKKQTNITGVSVNGNVLMIGQAPNSMLRDKAVKVVQDLKLGGKIHNQIRIGNPTSFTTRS
NDTWVTTKVKGRMLNEKALDVTRIKVITENGEVFLLGLIHRSQAELAVDIARNTAGVRKV
VKVFEYIE