Protein Info for SO0286 in Shewanella oneidensis MR-1

Name: aroK
Annotation: shikimate kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01202: SKI
  • amino acids 13 to 169 (157 residues), 197.9 bits, E=5.8e-63

Best Hits

Swiss-Prot: 100% identical to AROK_SHEON: Shikimate kinase (aroK) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 98% identity to sbm:Shew185_4084)

MetaCyc: 79% identical to shikimate kinase 1 (Escherichia coli K-12 substr. MG1655)
Shikimate kinase. [EC: 2.7.1.71]

Predicted SEED Role

"Shikimate kinase I (EC 2.7.1.71)" in subsystem Benzoate transport and degradation cluster or Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.7.1.71)

MetaCyc Pathways

• superpathway of chorismate metabolism (50/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.71

Sequence Analysis Tools

See Q8EK20 at UniProt or InterPro

Protein Sequence (171 amino acids)

>SO0286 shikimate kinase (NCBI ptt file) (Shewanella oneidensis MR-1)
MAEKRNIFLVGPMGAGKSTIGRHLAQMLHLEFHDSDQEIEQRTGADIAWVFDVEGEEGFR
RREAQVIADLSEKQGIVLATGGGSVQSKDIRNHLSARGIVVYLETTIDKQVARTQRDKRR
PLLQVDDPREVLESLAEIRNPLYEEIADVVVKTDDQSAKVVANQIIEKLGF