Protein Info for SO0272 in Shewanella oneidensis MR-1

Name: cinA
Annotation: competence/damage-inducible protein CinA (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 TIGR00200: competence/damage-inducible protein CinA N-terminal domain" amino acids 1 to 407 (407 residues), 386.3 bits, see alignment E=2.2e-119 TIGR00177: molybdenum cofactor synthesis domain" amino acids 1 to 162 (162 residues), 89.8 bits, see alignment E=2.4e-29 PF00994: MoCF_biosynth" amino acids 5 to 169 (165 residues), 112 bits, see alignment E=2e-36 PF02464: CinA" amino acids 253 to 406 (154 residues), 181.4 bits, see alignment E=9.3e-58 TIGR00199: amidohydrolase, PncC family" amino acids 262 to 407 (146 residues), 137 bits, see alignment E=8.2e-44

Best Hits

Swiss-Prot: 100% identical to PNCC_SHEON: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03742, competence/damage-inducible protein CinA (inferred from 100% identity to son:SO_0272)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EK32 at UniProt or InterPro

Protein Sequence (424 amino acids)

>SO0272 competence/damage-inducible protein CinA (NCBI ptt file) (Shewanella oneidensis MR-1)
MKLEMICTGEEVLSGQIVDTNAAWFASTMMEHGIEIQRRVTVGDRLEDLIAVFQERSLHA
DVILVNGGLGPTSDDMSAEAMAKAKGESLVENSEWRQRLEDWFTRNNREMPVSNLKQAML
PVSAVMVDNPVGTACGFRVKLNRAWLFFTPGVPFELKHMVKEQFIPFIRDEFNLDAKVAL
KKLLTIGHGESALADKIEPLELPEGITIGYRSSMPHIEIKIFARGEKAIALLPRVAGHIK
MVLGTAVVAEDKATLAEEIHFRLLNSGLTLSAAESCTGGMITSQLVDFPGSSSYLQHGLV
TYSNESKVRVLGVNPATLDDHGAVSIPTVEEMAKGARAILDSDFALATSGIAGPDGGTED
KPVGTVAIALATRSGVYSQMIKLPRRSRDLVRSLSAAVAYDMLRRELLSEAVIVDYQSIG
RFSK