Protein Info for SO0254 in Shewanella oneidensis MR-1

Name: rpsK
Annotation: ribosomal protein S11 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to RS11_SHEB5: 30S ribosomal protein S11 (rpsK) from Shewanella baltica (strain OS155 / ATCC BAA-1091)

KEGG orthology group: K02948, small subunit ribosomal protein S11 (inferred from 96% identity to swd:Swoo_4667)

MetaCyc: 85% identical to 30S ribosomal subunit protein S11 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S11p (S14e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P59375 at UniProt or InterPro

Protein Sequence (130 amino acids)

>SO0254 ribosomal protein S11 (NCBI ptt file) (Shewanella oneidensis MR-1)
MAKVPSRSPRKRVRKQVADGMAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKST
PFAAQVAAERAGAAAQDYGLKNLEVFVKGPGPGRESAIRALNAVGYKITNITDVTPIPHN
GCRPPKKRRV