Protein Info for SO0246 in Shewanella oneidensis MR-1

Name: rplF
Annotation: ribosomal protein L6 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 TIGR03654: ribosomal protein uL6" amino acids 2 to 176 (175 residues), 235.8 bits, see alignment E=1.3e-74 PF00347: Ribosomal_L6" amino acids 11 to 82 (72 residues), 63.4 bits, see alignment E=1.4e-21 amino acids 90 to 164 (75 residues), 72.5 bits, see alignment E=2.1e-24

Best Hits

Swiss-Prot: 100% identical to RL6_SHEON: 50S ribosomal protein L6 (rplF) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02933, large subunit ribosomal protein L6 (inferred from 98% identity to spc:Sputcn32_3744)

MetaCyc: 64% identical to 50S ribosomal subunit protein L6 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L6p (L9e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EK54 at UniProt or InterPro

Protein Sequence (177 amino acids)

>SO0246 ribosomal protein L6 (NCBI ptt file) (Shewanella oneidensis MR-1)
MSRVAKAPVSIPAGVEVTLNEQTLTVKGAKGSLTRVINNAVNVVIENGVIKFLPVEGAVG
AWAQAGTTRALVNNMVVGVSQGFERKLKLVGVGYRAKLVGADIDLTLGFSHPLVHKLPAG
VTAECPSQTDIVLRGVDKQLIGQVAAEIRGYRPPEPYKGKGVRYDDEEVRRKEAKKK