Protein Info for SO0195 in Shewanella oneidensis MR-1

Name: ybbB
Annotation: ybbB protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF00581: Rhodanese" amino acids 13 to 128 (116 residues), 22.9 bits, see alignment E=4.8e-09 TIGR03167: tRNA 2-selenouridine synthase" amino acids 19 to 349 (331 residues), 367.7 bits, see alignment E=2.8e-114

Best Hits

Swiss-Prot: 100% identical to SELU_SHEON: tRNA 2-selenouridine/geranyl-2-thiouridine synthase (selU) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K06917, tRNA 2-selenouridine synthase [EC: 2.9.1.-] (inferred from 100% identity to son:SO_0195)

Predicted SEED Role

"Selenophosphate-dependent tRNA 2-selenouridine synthase" in subsystem Selenocysteine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKA0 at UniProt or InterPro

Protein Sequence (376 amino acids)

>SO0195 ybbB protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTTTLIPAQQYRDIFVAGKPLIDLRAPIEFNRGAFPSSVNLPLMVDKEREKVGTCYKQQG
QQAAIALGHSLVHGAVKQQRIDAWLGFLAAQPEAYLYCFRGGLRSQLTQQWLKEAGATVP
YVQGGYKGMRQYLIGVIETTPSQQPLLSLSGMTGSGKTDFLIQRKEAVDLEGIANHRGSS
FGKNIDPQPTQINFENQLAIALLRHQQDNHSCLLLEDESFLIGRSALPQSFYNAMQAADI
LVLEEADDIRLNRLLDEYVHKMHQGFVERLGIEAGFNAFSQYLLQSLTSIRKRLGGKQYQ
ELQDTMQQALSQQLNQNQTSQHLAWINLLLQKYYDPMYEYQLEKKAHRVLFRGNHQAMHE
WLDNLSQDSLSQENLG