Protein Info for SO0192 in Shewanella oneidensis MR-1

Annotation: acetyltransferase, GNAT family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00583: Acetyltransf_1
  • amino acids 14 to 123 (110 residues), 66 bits, E=7.7e-22
• PF13673: Acetyltransf_10
  • amino acids 41 to 129 (89 residues), 49.4 bits, E=9.3e-17
• PF13508: Acetyltransf_7
  • amino acids 42 to 124 (83 residues), 51.8 bits, E=1.8e-17
• PF08445: FR47
  • amino acids 71 to 126 (56 residues), 25.3 bits, E=2.5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0192)

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

See Q8EKA3 at UniProt or InterPro

Protein Sequence (147 amino acids)

>SO0192 acetyltransferase, GNAT family (NCBI ptt file) (Shewanella oneidensis MR-1)
MQLIRPVLKSELAAVFQLEQAIFGEHSYPDFFFRQGFDCWPEYFLVAADANGVLLGYLLG
AQSSDPECMWILSVAVSEQARGQGLGKQLLQRCLALLPAKVKRVDLTVDPHNPARSLYQR
LGFVDAHVEANYFGAGADRVVMSYHCR