Protein Info for SO0190 in Shewanella oneidensis MR-1

Annotation: MutT/nudix family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF00293: NUDIX" amino acids 48 to 147 (100 residues), 51.7 bits, see alignment E=4.8e-18

Best Hits

Swiss-Prot: 60% identical to NUDE_ECOLI: ADP compounds hydrolase NudE (nudE) from Escherichia coli (strain K12)

KEGG orthology group: K08312, ADP-ribose diphosphatase [EC: 3.6.1.-] (inferred from 100% identity to son:SO_0190)

MetaCyc: 60% identical to ADP-sugar diphosphatase NudE (Escherichia coli K-12 substr. MG1655)
ADP-sugar diphosphatase. [EC: 3.6.1.21]

Predicted SEED Role

"ADP compounds hydrolase NudE (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKA5 at UniProt or InterPro

Protein Sequence (183 amino acids)

>SO0190 MutT/nudix family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSKRHHKPEILHTEVVAKSRLFQIEQVHLKFSNGVERQYERLKGGGRGAVMVVPIHRGNM
LLAREYAAGTDNYELGFPKGLIDPGEQAIDAANRELQEEIGFGARKLTLLKELTLAPGYF
SSKMQIFMAEDLYESRLEGDEPEPIDVVPWPLAEWEVLLNNIDFSESRSVSALFLAQKHL
QLK