Protein Info for SO0167 in Shewanella oneidensis MR-1

Name: gspE
Annotation: general secretion pathway protein E (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 TIGR02533: type II secretion system protein E" amino acids 35 to 518 (484 residues), 732.7 bits, see alignment E=9.3e-225 PF22341: GSPE_N1E" amino acids 36 to 99 (64 residues), 70.7 bits, see alignment E=9.2e-24 PF00437: T2SSE" amino acids 136 to 516 (381 residues), 531.8 bits, see alignment E=7.1e-164

Best Hits

Swiss-Prot: 69% identical to GSPE_VIBCH: Type II secretion system protein E (epsE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 100% identity to son:SO_0167)

Predicted SEED Role

"General secretion pathway protein E"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKC8 at UniProt or InterPro

Protein Sequence (521 amino acids)

>SO0167 general secretion pathway protein E (NCBI ptt file) (Shewanella oneidensis MR-1)
MSEIQVSQVEDLSLVSNELGLEAEGDEVFRSSSKERLPFAFAHRHQVILAYGDDGALNLF
YTAHTPLAAMLEARRYSGVDLPLVLLEPNKFEVKLTQAYQANSSEAQQLMEDIGNEMDLF
TLAEELPQTEDLLEGDDDAPIIKLINALLSEAIKEEASDIHIETYEKQLVVRFRIDGVLK
EVLKPNRKLSSLLVSRIKVMARLDIAEKRVPQDGRISLRIAGRAVDVRVSTMPSSHGERV
VLRLLDKNAGNLDLKQLGMTDSIRAKFDELIRRPHGIILVTGPTGSGKSTTLYAGLTEIN
SKDTNILTVEDPIEYELEGIGQTQVNTKADMTFARGLRAILRQDPDVVMIGEIRDLETAQ
IAVQASLTGHLVISTLHTNTASGAITRLQDMGVEPFLVSSSLLGVLAQRLIRTLCPKCKT
EHTPDERERELLGITADDPRHIYRANGCKACGGSGYRGRTGIHELLLVDDNVRELIHGGR
GELAIEKYIRQSVPSIRHDGMSKVLLGITTLEEVLRVTREE