Protein Info for SO0163 in Shewanella oneidensis MR-1

Name: hslO
Annotation: chaperonin HslO (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF01430: HSP33" amino acids 4 to 268 (265 residues), 272.5 bits, see alignment E=2.2e-85

Best Hits

Swiss-Prot: 100% identical to HSLO_SHEON: 33 kDa chaperonin (hslO) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K04083, molecular chaperone Hsp33 (inferred from 100% identity to son:SO_0163)

Predicted SEED Role

"33 kDa chaperonin (Heat shock protein 33) (HSP33)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKD2 at UniProt or InterPro

Protein Sequence (286 amino acids)

>SO0163 chaperonin HslO (NCBI ptt file) (Shewanella oneidensis MR-1)
MTQDILHRYLFDNADVRGELVQLQNSYQQVIGSHAYPPVLQTLLGELLAATSLLTATLKF
SGDISVQLQGNGPVSLAVINGNNLQQLRGIARWDGELADDASLADLFGQGYMVITLTPDE
GERYQGVVALDKPTLAACVEDYFNQSEQLPTALWLFADGKQAAGMFLQILPSQEDHNADF
EHLCQLTATIKAEELFTLEAQEVLHRLYHQEEVRLFDPIEVSFKCTCSRERSAAAIKTID
QAEVEAILAEDGNVEMGCEYCNAKYLFDAIDIASIYANGTASNTQQ