Protein Info for SO0160 in Shewanella oneidensis MR-1

Annotation: transporter, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 28 to 51 (24 residues), see Phobius details amino acids 71 to 100 (30 residues), see Phobius details amino acids 124 to 155 (32 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 351 to 368 (18 residues), see Phobius details amino acids 388 to 410 (23 residues), see Phobius details amino acids 417 to 435 (19 residues), see Phobius details amino acids 448 to 466 (19 residues), see Phobius details amino acids 478 to 503 (26 residues), see Phobius details PF03806: ABG_transport" amino acids 12 to 513 (502 residues), 592.3 bits, see alignment E=3e-182

Best Hits

KEGG orthology group: K12942, aminobenzoyl-glutamate transport protein (inferred from 100% identity to son:SO_0160)

Predicted SEED Role

"Aminobenzoyl-glutamate transport protein" in subsystem p-Aminobenzoyl-Glutamate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKD5 at UniProt or InterPro

Protein Sequence (519 amino acids)

>SO0160 transporter, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MDNHKHATGFQRFLNTVETLGNKLPDPAVLFAIFLGLVWLISWWLSGVSFAEIDPRTGNP
IKVVNMLEGGALTAFTSTLVSTFVTFPPLGVVLVAMLGLGVAEHTGFINAGLRSILSVTP
KMLLTPVLIAVGILSHVAVDAGYVLVIPLGAVIFYAAGRHPLAGIAAAFAGVSGGFSATV
GVPSSLDPMLAGLTQAAARLSADPAAATLTINPLNNIFFTSASAILIILVGWFITDKVIE
PRLKKTAVNGDPATLPTLDELQPNERRGLRFAMLSMLLCVLGLVLTAYGDNSAWRGEDGG
LTSASAPLMRSIVAIIFVFFLIPGIVYGYVAGTANNHRAIIQGMSKSMSGMGYYIVMAFF
CAQFIYAFGQSNLGALMAIKGALALKELALPLSVTLVGIIFLTALVNLLVGSASAKWALI
GAIMVPMLMELGVSPDLTQAAYRVGDSSTNIITPLMPYFPLIVVFCQKYVKESGIGTLIA
LMLPFSISFLLLWSAFLLVYWALGLPLGIGSTLTFPAIP