Protein Info for SO0157 in Shewanella oneidensis MR-1

Annotation: proton/glutamate symporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 35 to 35 (1 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 76 to 100 (25 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 179 to 204 (26 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 263 to 279 (17 residues), see Phobius details amino acids 295 to 319 (25 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details PF00375: SDF" amino acids 12 to 401 (390 residues), 393.5 bits, see alignment E=5.4e-122

Best Hits

Swiss-Prot: 36% identical to GLTT_BACSU: Proton/sodium-glutamate symport protein (gltT) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to son:SO_0157)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKD8 at UniProt or InterPro

Protein Sequence (412 amino acids)

>SO0157 proton/glutamate symporter (NCBI ptt file) (Shewanella oneidensis MR-1)
MKSKSLLGNIGVQVVIAMIIGALVGFMMGESASIFAPLGTIFIHLIKMLVIPLVLVSIIS
GAASLGDSPSAGKIGVGTFGFFIITSGLAVALALVMGSIFTPGAGVDFTAHSSSDLMEVT
KEHGALPGVIDTFIGMIPTNVFESLNGGNILQILVFSIFFGIALTKVKGDGAKPIMAALN
TVVDAFVWMINCVMVIAPIGVFGLMADSVGTFGFDALEVVFKLFAVFVAAILIYGFVFFP
LVVQLFSKVSARQFISAMKKPQVMALSTASSMATLPVNMETCEEDLKVSKATTAFVLPLG
ATINMSGNAIYYGLVAMFFAQMYNIDLSMTAYAAIIFTSTLGAIGQAGVPGPSFLVVAVL
LAAGIPIDGLPLLFALDRVFDMIRTALNITGDAACAVIMDKYTAEQLTQEPS