Protein Info for SO0154 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details PF11744: ALMT" amino acids 19 to 187 (169 residues), 56.8 bits, see alignment E=3e-19 PF04632: FUSC" amino acids 20 to 312 (293 residues), 113.7 bits, see alignment E=1.6e-36 PF13515: FUSC_2" amino acids 32 to 157 (126 residues), 51.8 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0154)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKE1 at UniProt or InterPro

Protein Sequence (374 amino acids)

>SO0154 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSVFAPASPFADFIYRHFRAIHALKLGLALLIAVIINAIWSPPHFIWSMVTIVIIMMSLP
QVGGAIEKSLQRAVGTCLGSAYGVMLVATIDSYWLIMGLLILGVTLICFISAGRYSYAYL
VAGFTIIIVVGDASHDTSEALWRTANILLGCVIAILVSLFIFPIKAKHDWRSQLANAINS
MAKVLTQHLQAPANHDLDFRADLEAAMKAVLTQKKLFFSLEWESQTLKKHKVLLAELVNK
QVRLITLLELLPLSRWQEADKEAYHQINNVAAELTAYLQRLGEFVAGKTATLPTLPNALE
QELQHRLQLTLATPAPDHTSTSVANEVAQGFALTGYGWLIYQLAIAVEALYADIEIIEAA
YNGQIKLHKIANPA