Protein Info for SO0151 in Shewanella oneidensis MR-1

Annotation: hypothetical SAM-dependent methyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF08242: Methyltransf_12" amino acids 52 to 146 (95 residues), 33.2 bits, see alignment E=1.8e-11 PF13649: Methyltransf_25" amino acids 52 to 144 (93 residues), 44.6 bits, see alignment E=5e-15 PF08241: Methyltransf_11" amino acids 53 to 147 (95 residues), 38.9 bits, see alignment E=2.7e-13 PF13847: Methyltransf_31" amino acids 59 to 177 (119 residues), 31.9 bits, see alignment E=2.6e-11 PF01209: Ubie_methyltran" amino acids 64 to 153 (90 residues), 21.4 bits, see alignment E=3.5e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0151)

Predicted SEED Role

"FIG01058185: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKE4 at UniProt or InterPro

Protein Sequence (255 amino acids)

>SO0151 hypothetical SAM-dependent methyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MDYLTTNKIAWDARTRVHLTSDFYDVEGFLSGKISLTEIELNELAVAGKSLLHLQCHFGL
DTLSWARMGAKVTGVDLSEVAIAEACKLAQQTQLSAEFICSDVYSVVGKVEPQDIVFTSY
GAIVWLPDLTLWAQTIAACLKPGGQFYMAEFHPAQQLFDGYSYFNRGEPDIEQEGTYTEN
ASDDQQTLMCWSHSLSEVINALLQAGLELVFFHEFAFSPYNCFEGLEAQADGRYVLIHQG
QQVPLVYSISARKPV