Protein Info for SO0136 in Shewanella oneidensis MR-1

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 165 to 182 (18 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details PF01027: Bax1-I" amino acids 23 to 217 (195 residues), 106.6 bits, see alignment E=8e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0136)

Predicted SEED Role

"FIG00761799: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKF7 at UniProt or InterPro

Protein Sequence (220 amino acids)

>SO0136 hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MDTENSVFDRRTTNDTIIGAGLYNLVIGLTLVWGFAVNYAMVSHIDPEAIASVNPWIFFI
GYFASCFLGIYLFQSSSSPIVSFVGYNFVVVPFGLIINMVVSQYDPALVTEAIRITGLVT
IAMMCLGTLFPAFFQKISGVLTIALLLVIVVELIEIFIFKTHHGILDWIVVLIFCGYIGY
DWGRANQIPKTVDNAVDSAAALYMDIINLFLRILRILGRK