Protein Info for SO0127 in Shewanella oneidensis MR-1

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 68 (26 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 135 to 151 (17 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 250 to 276 (27 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 335 to 359 (25 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 393 to 415 (23 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_0127)

Predicted SEED Role

"FIG01056842: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKG6 at UniProt or InterPro

Protein Sequence (504 amino acids)

>SO0127 hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLIHILPELLEHGGLLAIVFVILGLWGPTASERLFHRYSEITHNFALFLGISGLLLHTIT
DGTAMVLAQQDGNSILLALGVILHRLPVGFAVWWILKPHLGVRWTLIIFAAIMLFTSIGY
FASEQLLSHMSIDKTVYLQAFVTGSILHVVLHQPHGQQDVDKQGRYEYQAGIGSLLGIGL
LMMLLLVDSGGHDHAHHNHSAEQLTTWLMTIAPVLLLSYAVAALRFKLGLTPQDNSLARR
WFQRLAGPEALVLTALLLGPWLALFQLLVSFVMSAYLANAQVEITDPHTTLPSKALRFGF
AHLVDRSAPWVLLSLVLVNLIGHPSVPLNNPMLQIAVLLLVFLPMRFCNLGAAVLSIALA
YSGWSPLAIILPLIAAPVLSIAQLRLMNWPQRAILLAMIAIALVAALKLPMWFSLITLPE
AINLVALLILSALFAASLLRLGPRKFLRRLMMLKPTAHGHKHSHDHAHTHAHSTVLPTPN
SPTHSHDSSHGHTHDHADRDKHHH