Protein Info for SO0108 in Shewanella oneidensis MR-1

Annotation: hypothetical transporter component (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 113 to 138 (26 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details PF04143: Sulf_transp" amino acids 4 to 160 (157 residues), 83.5 bits, see alignment E=1e-27 amino acids 237 to 393 (157 residues), 89.5 bits, see alignment E=1.6e-29

Best Hits

Swiss-Prot: 80% identical to YEDE_ECOLI: UPF0394 inner membrane protein YedE (yedE) from Escherichia coli (strain K12)

KEGG orthology group: K07112, (no description) (inferred from 100% identity to son:SO_0108)

Predicted SEED Role

"Putative transport system permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EKI5 at UniProt or InterPro

Protein Sequence (404 amino acids)

>SO0108 hypothetical transporter component (NCBI ptt file) (Shewanella oneidensis MR-1)
MTWQQFKQQYLVRFWAPMPAVIAAGILSTYYFGLTGTFWAVTGEFTRWGGHLLQLVGANP
ETWGYFKVIGLQGSPLDRIDGMMIIGMFGGCIAAALWANNVKLRMPQSRIRIAQALIGGI
IAGFGARLAMGCNLAAFFTGIPQFSLHAWFFALATAAGSYFGARFTLLPMFRIPVKLKKV
DKASSVKQDENQARLRFRIGMLVFAAIIGWGLLTMFNAPKLGIAMLCGVGFGLLIERAQI
CFTSAFRDMWITGRTHMAKAIILGMAVSAIGIYSYVQLGVPPKIMWAGPNAVIGGLLFGF
GIVLAGGCETGWMYRAVEGQVHFWWVGLGNVLGSTLLAYYWDDLAQPLATNWDKVNLLTS
FGDKGGLLVTYLLLALSFAAMLLWEKRFFARKAKRDEQLIAEAA